PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00116168001
Common NameGSBRNA2T00116168001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 345aa    MW: 37476.9 Da    PI: 7.6362
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00116168001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.6e-3952112262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          k++a++cprC+s ntkfCyynnysl+qPr+fCk+CrryWt+GG+lrn+PvGgg+rknk+s+
  GSBRNA2T00116168001  52 KDQAVNCPRCNSINTKFCYYNNYSLTQPRFFCKGCRRYWTEGGSLRNIPVGGGSRKNKRSH 112
                          7899******************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2841104IPR003851Zinc finger, Dof-type
PfamPF027014.4E-3353110IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.32356110IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105894IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MDTAQWPQQE MVVKPLEEIV TNTCPKPQPS QPQQPTPDGA AGGVERKARP EKDQAVNCPR  60
CNSINTKFCY YNNYSLTQPR FFCKGCRRYW TEGGSLRNIP VGGGSRKNKR SHSSSVSSSS  120
DINKNHSDST QPATKKHHSD HHHLISMSQQ GLTGQNPKFY ETTQQDLNLG FPPHGLIRTN  180
FTDLIHNIGN NNKSTNNPLT SSSTTSAMAV SSLDLIRNNT SNNGSSSFMG FPFHNQDPTS  240
GGFSMQDHYK PCNSNTTLLG FSLDHHHNNG FHGGFQEGEG GGEAGDDVNG RHLFPFEDLK  300
LPVSSSSATI NVDINDNQKR ASGGDASANS GGYWTGMLNG GSWC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.164561e-149flower
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00116168001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3171530.0AK317153.1 Arabidopsis thaliana AT4G24060 mRNA, complete cds, clone: RAFL21-94-L04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013671499.10.0PREDICTED: dof zinc finger protein DOF4.6-like
SwissprotQ8LAP81e-175DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLA0A078ES430.0A0A078ES43_BRANA; BnaC01g15880D protein
STRINGBra013758.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34332761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-138Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]